PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008241536.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family LBD
Protein Properties Length: 312aa    MW: 34398.6 Da    PI: 7.5276
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008241536.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.74.9e-4471061100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv k+l++l+ ++reda++sl+yeAear+rdPvyG+vg+i+ lqq+l+q++a+l 
  XP_008241536.1   7 PCAACKFLRRKCTQECVFAPYFPPDQPQKFANVHKVFGASNVAKILNELNATQREDAVNSLAYEAEARLRDPVYGCVGLISILQQRLKQVQADLY 101
                     7*********************************************************************************************9 PP

          DUF260  96 llkee 100
                      +k+e
  XP_008241536.1 102 NAKKE 106
                     98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.0316107IPR004883Lateral organ boundaries, LOB
PfamPF031952.2E-437104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MSSSNSPCAA CKFLRRKCTQ ECVFAPYFPP DQPQKFANVH KVFGASNVAK ILNELNATQR  60
EDAVNSLAYE AEARLRDPVY GCVGLISILQ QRLKQVQADL YNAKKELATY MGPQAMLSIL  120
QPPPTYMPQQ LQGNASSSAV SPYTMSPMMG ISTGPTSGQL MIREPQQQQQ QQQMFEAQQL  180
AAAVAAREQQ EMFRSFDQSK QSMQQGQEHV RFNSGFDLSP GSVTVSGFTQ MAGAVCNAVS  240
PSLALGFDSN SYHHQIQPQQ SHHHHQLQLQ AQLLLQTQQP QGQHQNQQSQ QTQLQQKSDP  300
GEEGGRSVGP SC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008241538.10.0PREDICTED: LOB domain-containing protein 36
RefseqXP_008241537.10.0PREDICTED: LOB domain-containing protein 36
RefseqXP_008241536.10.0PREDICTED: LOB domain-containing protein 36
SwissprotQ9FKZ32e-89LBD36_ARATH; LOB domain-containing protein 36
TrEMBLM5W6J80.0M5W6J8_PRUPE; Uncharacterized protein
STRINGVIT_07s0197g00020.t011e-108(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.11e-83ASYMMETRIC LEAVES 2-like 1